• Gene id: 161502

Gene Summary

• Gene Symbol: CFAP161   Gene   UCSC   Ensembl
• Aliases: C15orf26
• Gene name: cilia and flagella associated protein 161
• Alternate names: cilia- and flagella-associated protein 161,
• Gene location: 15q25.1 (13906164: 13882347)     Exons: 11     NC_000019.10

Protein Summary

• Protein general information: Q6P656  
  • Name: Cilia and flagella associated protein 161
  • Length: 301  
  • Mass: 34294
• Sequence:

  MAQNVYGPGVRIGNWNEDVYLEEELMKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNP
  DDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLG
  ITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCWQAAFPDPQLRLEYEGFPVPANAKILINHCHTN
  RGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLVTGNPRDASSSMLDLPKPPTEDTRAMEQAMGLDT
  Q

• Structural information:
  • STRING: ENSP00000286732
• Other Databases: GeneCards:  CFAP161  Malacards:  CFAP161

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)