• Gene id: 160897

Gene Summary

• Gene Symbol: GPR180   Gene   UCSC   Ensembl
• Aliases: ITR
• Gene name: G protein-coupled receptor 180
• Alternate names: integral membrane protein GPR180, intimal thickness-related receptor,
• Gene location: 13q32.1 (94601856: 94634660)     Exons: 15     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling. [provided by RefSeq
• OMIM: 607787

Protein Summary

• Protein general information: Q86V85  
  • Name: Integral membrane protein GPR180 (Intimal thickness related receptor)
  • Length: 440  
  • Mass: 49395
• Sequence:

  MGGLRLLAVALTCCWWPQGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQ
  AQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVL
  LNPDAEGNPFDHFSAGESGLHEFFFLLVLVYFVIACIYAQSLWQAIKKGGPMHMILKVLTTALLLQAGSALANYI
  HFSSYSKDGIGVPFMGSLAEFFDIASQIQMLYLLLSLCMGWTIVRMKKSQSRPLQWDSTPASTGIAVFIVMTQSV
  LLLWEQFEDISHHSYHSHHNLAGILLIVLRICLALSLGCGLYQIITVERSTLKREFYITFAKGCILWFLCHPVLA
  CISVIFSDYQRDKVITIGVILCQSVSMVILYRLFLSHSLYWEVSSLSSVTLPLTISSGHKSRPHF

• Structural information:
  • Interpro: IPR019336  
  • STRING: ENSP00000366157
• Other Databases: GeneCards:  GPR180  Malacards:  GPR180

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0019236	response to pheromone	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)