• Gene id: 1606

Gene Summary

• Gene Symbol: DGKA   Gene   UCSC   Ensembl
• Aliases: DAGK, DAGK1, DGK-alpha
• Gene name: diacylglycerol kinase alpha
• Alternate names: diacylglycerol kinase alpha, 80 kDa diacylglycerol kinase, DAG kinase alpha, diacylglycerol kinase, alpha 80kDa, diglyceride kinase alpha,
• Gene location: 12q13.2 (55931090: 55954022)     Exons: 33     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important rol
• OMIM: 125855

Protein Summary

• Protein general information: P23743  
  • Name: Diacylglycerol kinase alpha (DAG kinase alpha) (EC 2.7.1.107) (80 kDa diacylglycerol kinase) (Diglyceride kinase alpha) (DGK alpha)
  • Length: 735  
  • Mass: 82630
  • Tissue specificity: Lymphocytes and oligodendroglial cells.
• Sequence:

  MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALF
  QSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLD
  WDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESS
  IGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
  VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTH
  PLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANL
  PVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYF
  SIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
  NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNA
  GRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

• Structural information:
  • Protein Domains: (110..14-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (155..19-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (372..50-)
    (/note="DAGKc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU007-)
  • Interpro: IPR017438  IPR029477  IPR037607  IPR038199  IPR000756   IPR001206  IPR011992  IPR018247  IPR002048  IPR016064  IPR002219  
  • Prosite: PS50146 PS00018 PS50222 PS00479 PS50081
  • CDD: cd00029 cd00051
  • PDB: 1TUZ 6IIE
  • PDBsum: 1TUZ 6IIE
  • STRING: ENSP00000328405
• Other Databases: GeneCards:  DGKA  Malacards:  DGKA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004143	diacylglycerol kinase activity	IBA	molecular function
GO:0046834	lipid phosphorylation	IBA	biological process
GO:0046486	glycerolipid metabolic process	IBA	biological process
GO:0046339	diacylglycerol metabolic process	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006654	phosphatidic acid biosynthetic process	IDA	biological process
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0006654	phosphatidic acid biosynthetic process	IDA	biological process
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0003951	NAD+ kinase activity	IEA	molecular function
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0008289	lipid binding	IDA	molecular function
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0006654	phosphatidic acid biosynthetic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046486	glycerolipid metabolic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0046486	glycerolipid metabolic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881