• Gene id: 160065

Gene Summary

• Gene Symbol: PATE1   Gene   UCSC   Ensembl
• Aliases: PATE
• Gene name: prostate and testis expressed 1
• Alternate names: prostate and testis expressed protein 1, expressed in prostate and testis,
• Gene location: 11q24.2 (125746292: 125749847)     Exons: 5     NC_000011.10
• OMIM: 606861

Protein Summary

• Protein general information: Q8WXA2  
  • Name: Prostate and testis expressed protein 1
  • Length: 126  
  • Mass: 14,271
• Sequence:

  MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKCSRGRGICTATTEEAC
  MVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHDLCNEDL

• Structural information:
  • Protein Domains: UPAR/Ly6. (46-125)
  • STRING: ENSP00000307164
• Other Databases: GeneCards:  PATE1  Malacards:  PATE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 26853019
Associated with mammalian sperm maturation	MIK: 15798027
Asthenozoospermia	MIK: 25637620
Male infertility	MIK: 27636828
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26853019	Asthenozoospermia				Male infertility
25637620	Asthenozoospermia			230 (60 young fathers, 60 aged fathers, 110 young asthenozoospermia patients)	Male infertility
15798027	Assocaited with mammalian sperm maturation				Male infertility
27636828	Idiopathic asthenozoospermia, Male infertility		Chinese	214 (108 idiopathic asthenozoospermia, 106 fertile men with normospermia)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)