• Gene id: 159963

Gene Summary

• Gene Symbol: SLC5A12   Gene   UCSC   Ensembl
• Aliases: SMCT2
• Gene name: solute carrier family 5 member 12
• Alternate names: sodium-coupled monocarboxylate transporter 2, electroneutral sodium monocarboxylate cotransporter, low-affinity sodium-lactate cotransporter, sodium-iodide related cotransporter, solute carrier family 5 (sodium/glucose cotransporter), member 12, solute carrier,
• Gene location: 11p14.2 (26723355: 26667019)     Exons: 18     NC_000011.10
• Gene summary(Entrez): Normal blood lactate is maintained at about 1.5 mM, and little filtered lactate is excreted in urine. Reabsorption of lactate is mediated by the low-affinity Na(+)-coupled lactate transporter SLC5A12 in the initial part of the proximal tubule and by the h
• OMIM: 612455

Protein Summary

• Protein general information: Q1EHB4  
  • Name: Sodium coupled monocarboxylate transporter 2 (Electroneutral sodium monocarboxylate cotransporter) (Low affinity sodium lactate cotransporter) (Solute carrier family 5 member 12)
  • Length: 618  
  • Mass: 67647
• Sequence:

  MEVKNFAVWDYVVFAALFFISSGIGVFFAIKERKKATSREFLVGGRQMSFGPVGLSLTASFMSAVTVLGTPSEVY
  RFGASFLVFFIAYLFVILLTSELFLPVFYRSGITSTYEYLQLRFNKPVRYAATVIYIVQTILYTGVVVYAPALAL
  NQVTGFDLWGSVFATGIVCTFYCTLGGLKAVVWTDAFQMVVMIVGFLTVLIQGSTHAGGFHNVLEQSTNGSRLHI
  FDFDVDPLRRHTFWTITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNLLGLWIILVCAVFSGLIMYSH
  FKDCDPWTSGIISAPDQLMPYFVMEIFATMPGLPGLFVACAFSGTLSTVASSINALATVTFEDFVKSCFPHLSDK
  LSTWISKGLCLLFGVMCTSMAVAASVMGGVVQASLSIHGMCGGPMLGLFSLGIVFPFVNWKGALGGLLTGITLSF
  WVAIGAFIYPAPASKTWPLPLSTDQCIKSNVTATGPPVLSSRPGIADTWYSISYLYYSAVGCLGCIVAGVIISLI
  TGRQRGEDIQPLLIRPVCNLFCFWSKKYKTLCWCGVQHDSGTEQENLENGSARKQGAESVLQNGLRRESLVHVPG
  YDPKDKSYNNMAFETTHF

• Structural information:
  • Interpro: IPR038377  IPR001734  IPR042700  
  • Prosite: PS50283
  • CDD: cd11520
  • STRING: ENSP00000379326
• Other Databases: GeneCards:  SLC5A12  Malacards:  SLC5A12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006814	sodium ion transport	IBA	biological process
GO:0015129	lactate transmembrane transporter activity	IBA	molecular function
GO:0015293	symporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0005343	organic acid:sodium symporter activity	TAS	molecular function
GO:0015129	lactate transmembrane transporter activity	IEA	molecular function
GO:0016324	apical plasma membrane	IEA	cellular component
GO:1903825	organic acid transmembrane transport	IEA	biological process
GO:0035873	lactate transmembrane transport	IEA	biological process
GO:0035873	lactate transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881