• Gene id: 159296

Gene Summary

• Gene Symbol: NKX2-3   Gene   UCSC   Ensembl
• Aliases: CSX3, NK2.3, NKX2.3, NKX2C, NKX4-3
• Gene name: NK2 homeobox 3
• Alternate names: homeobox protein Nkx-2.3, NK2 transcription factor related, locus 3, homeobox protein NK-2 homolog C,
• Gene location: 10q24.2 (150487694: 150468192)     Exons: 6     NC_000002.12
• Gene summary(Entrez): This gene encodes a homeodomain-containing transcription factor. The encoded protein is a member of the NKX family of homeodomain transcription factors. Studies of similar proteins in mouse and rat have indicated a potential role in cellular differentiati
• OMIM: 606727

Protein Summary

• Protein general information: Q8TAU0  
  • Name: Homeobox protein Nkx 2.3 (Homeobox protein NK 2 homolog C)
  • Length: 364  
  • Mass: 38406
• Sequence:

  MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNS
  LAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRK
  PRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRR
  VAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGG
  GGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQGIRAW

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000342828
• Other Databases: GeneCards:  NKX2-3  Malacards:  NKX2-3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0050900	leukocyte migration	IEA	biological process
GO:0048541	Peyer's patch development	IEA	biological process
GO:0048537	mucosal-associated lymphoid tissue development	IEA	biological process
GO:0043367	CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0048621	post-embryonic digestive tract morphogenesis	IEA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0030225	macrophage differentiation	IEA	biological process
GO:0022612	gland morphogenesis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0002317	plasma cell differentiation	IEA	biological process
GO:0001776	leukocyte homeostasis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)