Male Infertility Database

Search Result

Gene id

159091

Gene Summary Protein Summary Diseases PubMed

Gene Summary

Gene Symbol

FAM122C Gene UCSC Ensembl

Gene name

family with sequence similarity 122C

Alternate names

protein FAM122C,

Gene location

Xq26.3 (134796394: 134855136) Exons: 21 NC_000023.11

OMIM

Protein Summary

Protein general information

Q6P4D5

Name: Protein FAM122C

Length: 195 Mass: 22522

Sequence

MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSIS
RLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLVKWHFNINQKRFSKAQPTCFLLILPNCQKIMCIYF
QLLLMETTAMLDLLVIRQLKSALSQTLLCHLLILVLICSSRQTFN

Structural information

Interpro:	IPR026716
STRING:	ENSP00000359820

Other Databases

GeneCards: FAM122C Malacards: FAM122C

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All