• Gene id: 158584

Gene Summary

• Gene Symbol: FAAH2   Gene   UCSC   Ensembl
• Aliases: AMDD
• Gene name: fatty acid amide hydrolase 2
• Alternate names: fatty-acid amide hydrolase 2, amidase domain containing, amidase domain-containing protein, anandamide amidohydrolase 2, oleamide hydrolase 2,
• Gene location: Xp11.21 (51809444: 51319574)     Exons: 25     NC_000008.11
• Gene summary(Entrez): This gene encodes a fatty acid amide hydrolase that shares a conserved protein motif with the amidase signature family of enzymes. The encoded enzyme is able to catalyze the hydrolysis of a broad range of bioactive lipids, including those from the three m
• OMIM: 300654

Protein Summary

• Protein general information: Q6GMR7  
  • Name: Fatty acid amide hydrolase 2 (EC 3.5.1.99) (Amidase domain containing protein) (Anandamide amidohydrolase 2) (Oleamide hydrolase 2)
  • Length: 532  
  • Mass: 58304
  • Tissue specificity: Highly expressed in the brain, small intestine and testis. Also expressed in the heart, kidney, liver, lung and prostate. {ECO
• Sequence:

  MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDVVQAYI
  NRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMPNSSGLMNRRD
  AIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSSGGEGCTLAAACSVIGVGS
  DIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLAPMLKVMAGPGIKRLKLDTKV
  HLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKLKKMKYSFQLWIAMMSAKGHDGKEPV
  KFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKELVDMLGDDGVFL
  YPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVTQCPLGLNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGG
  WVCPGKF

• Structural information:
  • Interpro: IPR020556  IPR023631  IPR036928  
  • Prosite: PS00571
  • STRING: ENSP00000364035
• Other Databases: GeneCards:  FAAH2  Malacards:  FAAH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0103073	anandamide amidohydrolase activity	IEA	molecular function
GO:0102077	oleamide hydrolase activity	IEA	molecular function
GO:0017064	fatty acid amide hydrolase activity	TAS	molecular function
GO:0019369	arachidonic acid metabolic process	TAS	biological process
GO:0005811	lipid droplet	TAS	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881