• Gene id: 158521

Gene Summary

• Gene Symbol: FMR1NB   Gene   UCSC   Ensembl
• Aliases: CT37, NY-SAR-35, NYSAR35
• Gene name: FMR1 neighbor
• Alternate names: fragile X mental retardation 1 neighbor protein, cancer/testis antigen 37, sarcoma antigen NY-SAR-35,
• Gene location: Xq27.3-q28 (147981336: 148026664)     Exons: 6     NC_000023.11

Protein Summary

• Protein general information: Q8N0W7  
  • Name: Fragile X mental retardation 1 neighbor protein (Cancer/testis antigen 37) (CT37) (Sarcoma antigen NY SAR 35)
  • Length: 255  
  • Mass: 29241
  • Tissue specificity: Testis-specific. Expressed in melanoma, sarcoma, lung, breast, bladder, esophageal and ovarian cancers. {ECO
• Sequence:

  MSSHRRKAKGRNRRSHRAMRVAHLELATYELAATESNPESSHPGYEAAMADRPQPGWRESLKMRVSKPFGMLMLS
  IWILLFVCYYLSYYLCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQD
  LSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQMFGLGAISLILVCLPIYCRSLFWRSEPADDLQRQDNRVV
  TGLKKQRRKRKRKSEMLQKAARGREEHGDE

• Structural information:
  • Protein Domains: (125..18-)
    (/note="P-type"-)
  • STRING: ENSP00000359498
• Other Databases: GeneCards:  FMR1NB  Malacards:  FMR1NB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray