• Gene id: 158293

Gene Summary

• Gene Symbol: FAM120AOS   Gene   UCSC   Ensembl
• Aliases: C9orf10OS
• Gene name: family with sequence similarity 120A opposite strand
• Alternate names: uncharacterized protein FAM120AOS, FAM120A opposite strand protein,
• Gene location: 9q22.31 (93453600: 93443331)     Exons: 5     NC_000009.12
• Gene summary(Entrez): Differences in the expression level of this gene are associated with the survival rate of those with glioma. [provided by RefSeq, May 2017]
• OMIM: 615333

Protein Summary

• Protein general information: Q5T036  
  • Name: Uncharacterized protein FAM120AOS (FAM120A opposite strand protein)
  • Length: 256  
  • Mass: 27929
• Sequence:

  MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGGTRCPQ
  RRHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWTWLTICCAVWR
  SLPCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILP
  VKKISRSCSVNNKVSKKTTKPPTLRSFLSPI

• Structural information:
  • STRING: ENSP00000364561
• Other Databases: GeneCards:  FAM120AOS  Malacards:  FAM120AOS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)