• Gene id: 157574

Gene Summary

• Gene Symbol: FBXO16   Gene   UCSC   Ensembl
• Aliases: FBX16
• Gene name: F-box protein 16
• Alternate names: F-box only protein 16,
• Gene location: 8p21.1 (28490317: 28428407)     Exons: 9     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cul
• OMIM: 604019

Protein Summary

• Protein general information: Q8IX29  
  • Name: F box only protein 16
  • Length: 292  
  • Mass: 34588
  • Tissue specificity: Expressed in heart, spleen and colon. {ECO
• Sequence:

  MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCR
  KLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQG
  IWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKH
  PTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP

• Structural information:
  • Protein Domains: (86..13-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  
  • Prosite: PS50181
  • STRING: ENSP00000369604
• Other Databases: GeneCards:  FBXO16  Malacards:  FBXO16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray