Search Result
| Gene id | 157310 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | PEBP4 Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | CORK-1, CORK1, GWTM1933, HEL-S-300, PEBP-4, PRO4408, hPEBP4 | ||||||||||||||||||||||||
| Gene name | phosphatidylethanolamine binding protein 4 | ||||||||||||||||||||||||
| Alternate names | phosphatidylethanolamine-binding protein 4, cousin-of-RKIP 1 protein, epididymis secretory protein Li 300, epididymis secretory sperm binding protein, protein cousin-of-RKIP 1, | ||||||||||||||||||||||||
| Gene location |
8p21.3 (22941076: 22713250) Exons: 9 NC_000008.11 |
||||||||||||||||||||||||
| Gene summary(Entrez) |
The phosphatidylethanolamine (PE)-binding proteins, including PEBP4, are an evolutionarily conserved family of proteins with pivotal biologic functions, such as lipid binding and inhibition of serine proteases (Wang et al., 2004 [PubMed 15302887]).[suppli |
||||||||||||||||||||||||
| OMIM | 607817 | ||||||||||||||||||||||||
SNPs |
rs17088625 Strand: Allele origin: Allele change: Mutation type: snv NC_000008.11 g.22790337T>C NC_000008.10 g.22647850T>C|SEQ=[T/C]|GENE=PEBP4 |
||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q96S96 Name: Phosphatidylethanolamine binding protein 4 (PEBP 4) (hPEBP4) (Protein cousin of RKIP 1) Length: 227 Mass: 25733 Tissue specificity: Ubiquitously expressed. Highly expressed in tumor cells. {ECO | ||||||||||||||||||||||||
| Sequence |
MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWM EPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPSPPAHSGFHRY QFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHKNQAEIA AC | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: PEBP4  Malacards: PEBP4 | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||