Search Result
| Gene id | 155051 | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||
Gene Summary |
|||||||||||||||||
| Gene Symbol | CRYGN Gene UCSC Ensembl | ||||||||||||||||
| Gene name | crystallin gamma N | ||||||||||||||||
| Alternate names | gamma-crystallin N, gamma-N-crystallin, gammaN-crystallin, | ||||||||||||||||
| Gene location |
7q36.1 (151448789: 151428831) Exons: 7 NC_000007.14 |
||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the crystallin family of proteins that are localized to the refractive structure of vertebrate eye lenses. The protein encoded by this gene is unique in that it has both beta and gamma crystallin protein motifs. Alternative s |
||||||||||||||||
| OMIM | 601456 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
| Protein general information | Q8WXF5 Name: Gamma crystallin N (Gamma N crystallin) Length: 182 Mass: 20624 Tissue specificity: Not specifically expressed in eye. {ECO | ||||||||||||||||
| Sequence |
MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRW NSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAED FQLSSSLQSDQGPEEATTKPATTQPPFLTANL | ||||||||||||||||
| Structural information |
| ||||||||||||||||
| Other Databases | GeneCards: CRYGN  Malacards: CRYGN | ||||||||||||||||
Gene ontology
|
|||||||||||||||||
| |||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||
| |||||||||||||||||
PubMed references
|
|||||||||||||||||
| |||||||||||||||||