• Gene id: 154796

Gene Summary

• Gene Symbol: AMOT   Gene   UCSC   Ensembl
• Gene name: angiomotin
• Alternate names: angiomotin, angiomotin p130 isoform, angiomotin p80 isoform,
• Gene location: Xq23 (49610309: 49612719)     Exons: 1     NC_000010.11
• Gene summary(Entrez): This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger ve
• OMIM: 300410

Protein Summary

• Protein general information: Q4VCS5  
  • Name: Angiomotin
  • Length: 1084  
  • Mass: 118085
  • Tissue specificity: Expressed in placenta and skeletal muscle. Found in the endothelial cells of capillaries as well as larger vessels of the placenta. {ECO
• Sequence:

  MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQDHHQQLVAHA
  ARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQKMRTEGRPSVQ
  RLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLP
  NQHSLKGMEHRGPPPEYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPL
  SARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQAHQGDHYRLSQPGLS
  QQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQ
  ELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEK
  EYEGSEDTRKTISQLFAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYV
  DKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALE
  ADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKT
  LHAQIIEKDAMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLG
  ILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATA
  ATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAA
  PAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPD
  KTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI

• Structural information:
  • Interpro: IPR009114  IPR024646  
  • PDB: 6JJX
  • PDBsum: 6JJX
  • DIP: 53711
  • STRING: ENSP00000361027
• Other Databases: GeneCards:  AMOT  Malacards:  AMOT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IDA	molecular function
GO:0030334	regulation of cell migration	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0001726	ruffle	IDA	cellular component
GO:0034613	cellular protein localization	IDA	biological process
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0035329	hippo signaling	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035329	hippo signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001570	vasculogenesis	IEA	biological process
GO:0001702	gastrulation with mouth forming second	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0040019	positive regulation of embryonic development	IEA	biological process
GO:0042074	cell migration involved in gastrulation	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0003365	establishment of cell polarity involved in ameboidal cell migration	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0034613	cellular protein localization	IEA	biological process
GO:0043534	blood vessel endothelial cell migration	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0043532	angiostatin binding	IDA	molecular function
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0035329	hippo signaling	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030334	regulation of cell migration	IBA	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0005923	bicellular tight junction	IBA	cellular component
GO:0001525	angiogenesis	IBA	biological process
GO:0030027	lamellipodium	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0003365	establishment of cell polarity involved in ameboidal cell migration	IBA	biological process
GO:0008180	COP9 signalosome	IDA	colocalizes with
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa04390	Hippo signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881