• Gene id: 154043

Gene Summary

• Gene Symbol: CNKSR3   Gene   UCSC   Ensembl
• Aliases: CNK3, CNK3/IPCEF1, MAGI1
• Gene name: CNKSR family member 3
• Alternate names: connector enhancer of kinase suppressor of ras 3, CNK homolog protein 3, connector enhancer of KSR 3, maguin-like protein, membrane associated guanylate kinase, WW and PDZ domain containing 1, membrane-associated guanylate kinase-interacting protein-like 1,
• Gene location: 6q25.2 (154510684: 154387514)     Exons: 15     NC_000006.12
• OMIM: 606219

Protein Summary

• Protein general information: Q6P9H4  
  • Name: Connector enhancer of kinase suppressor of ras 3 (Connector enhancer of KSR 3) (CNK homolog protein 3) (CNK3) (CNKSR family member 3) (Maguin like protein)
  • Length: 555  
  • Mass: 61904
• Sequence:

  MEPVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQELVLEAVDLLCALNYG
  LETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEFLTSVVELIGAAKALLAWLDRAPFTGITDFS
  VTKNKIIQLCLDLTTTVQKDCFVAEMEDKVLTVVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNIKPGEGLGM
  YIKSTYDGLHVITGTTENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFNFT
  PAPLKNLRWKPPLVQTSPPPATTQSPESTMDTSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPL
  PGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARP
  RGHGRKGEDALCRYFSNERIPPIIEESSSPPYRFSRPTTERHLVRGADYIRGSRCYINSDLHSSATIPFQEEGTK
  KKSGSSATKSSSTEPSLLVSWFTRLKLLTH

• Structural information:
  • Protein Domains: (7..7-)
    (/note="SAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00184-)
    (80..17-)
    (/note="CRIC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00621-)
    (211..29-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (325..-)
  • Interpro: IPR010599  IPR017874  IPR001478  IPR036034  IPR001660   IPR013761  
  • Prosite: PS51290 PS50106 PS50105
  • STRING: ENSP00000475915
• Other Databases: GeneCards:  CNKSR3  Malacards:  CNKSR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033137	negative regulation of peptidyl-serine phosphorylation	ISS	biological process
GO:0010765	positive regulation of sodium ion transport	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000651	positive regulation of sodium ion transmembrane transporter activity	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0010765	positive regulation of sodium ion transport	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033137	negative regulation of peptidyl-serine phosphorylation	ISS	biological process
GO:0010765	positive regulation of sodium ion transport	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000651	positive regulation of sodium ion transmembrane transporter activity	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0010765	positive regulation of sodium ion transport	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881