• Gene id: 1539

Gene Summary

• Gene Symbol: CYLC2   Gene   UCSC   Ensembl
• Gene name: cylicin 2
• Alternate names: cylicin-2, cylicin II, cylicin, basic protein of sperm head cytoskeleton 2, multiple-band polypeptide II,
• Gene location: 9q31.1 (102995332: 103018487)     Exons: 8     NC_000009.12
• Gene summary(Entrez): Cylicin II (CYCL2) is specifically expressed in testis and is part of the cytoskeletal calyx of mammalian sperm heads. Cylicin II may play a role in the morphogenesis of the sperm head. [provided by RefSeq, Jul 2008]
• OMIM: 604035

Protein Summary

• Protein general information: Q14093  
  • Name: Cylicin 2 (Cylicin II) (Multiple band polypeptide II)
  • Length: 348  
  • Mass: 39079
  • Tissue specificity: Testis.
• Sequence:

  MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPL
  WMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKG
  KEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSK
  KGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDA
  KKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK

• Structural information:
  • Interpro: IPR026189  IPR029354  
  • STRING: ENSP00000420256
• Other Databases: GeneCards:  CYLC2  Malacards:  CYLC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005200	structural constituent of cytoskeleton	IEA	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0033150	cytoskeletal calyx	IEA	cellular component
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R