• Gene id: 153579

Gene Summary

• Gene Symbol: BTNL9   Gene   UCSC   Ensembl
• Aliases: BTN3, BTN8, VDLS1900
• Gene name: butyrophilin like 9
• Alternate names: butyrophilin-like protein 9, butyrophilin 3,
• Gene location: 5q35.3 (181039871: 181061524)     Exons: 14     NC_000005.10
• OMIM: 0

Protein Summary

• Protein general information: Q6UXG8  
  • Name: Butyrophilin like protein 9
  • Length: 535  
  • Mass: 59716
• Sequence:

  MVDLSVSPDSLKPVSLTSSLVFLMHLLLLQPGEPSSEVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWF
  RSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEV
  AGLGSDPHLSLEGFKEGGIQLRLRSSGWYPKPKVQWRDHQGQCLPPEFEAIVWDAQDLFSLETSVVVRAGALSNV
  SVSIQNLLLSQKKELVVQIADVFVPGASAWKSAFVATLPLLLVLAALALGVLRKQRRSREKLRKQAEKRQEKLTA
  ELEKLQTELDWRRAEGQAEWRAAQKYAVDVTLDPASAHPSLEVSEDGKSVSSRGAPPGPAPGHPQRFSEQTCALS
  LERFSAGRHYWEVHVGRRSRWFLGACLAAVPRAGPARLSPAAGYWVLGLWNGCEYFVLAPHRVALTLRVPPRRLG
  VFLDYEAGELSFFNVSDGSHIFTFHDTFSGALCAYFRPRAHDGGEHPDPLTICPLPVRGTGVPEENDSDTWLQPY
  EPADPALDWW

• Structural information:
  • Protein Domains: (54..13-)
    (/note="Ig-like-V-type)
    (310..50-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR007110  IPR036179   IPR013783  IPR003599  IPR013106  IPR006574  IPR003877  
  • Prosite: PS50188 PS50835
  • STRING: ENSP00000330200
• Other Databases: GeneCards:  BTNL9  Malacards:  BTNL9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0050776	regulation of immune response	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R