• Gene id: 152586

Gene Summary

• Gene Symbol: MGAT4D   Gene   UCSC   Ensembl
• Aliases: GnT1IP
• Gene name: MGAT4 family member D
• Alternate names: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D, GlcNAcT-I Inhibitory Protein, N-acetylglucosaminyltransferase MGAT1 inhibitory protein, glycosyltransferase 54 domain containing 1, glycosyltransferase 54 domain-conta,
• Gene location: 4q31.1 (140499045: 140442256)     Exons: 14     NC_000004.12
• OMIM: 123842

Protein Summary

• Protein general information: A6NG13  
  • Name: Alpha 1,3 mannosyl glycoprotein 4 beta N acetylglucosaminyltransferase like protein MGAT4D (N acetylglucosaminyltransferase MGAT1 inhibitory protein) (GlcNAcT I inhibitory protein) (GnT1IP)
  • Length: 374  
  • Mass: 43743
  • Tissue specificity: Expressed in testis. Poorly expressed in testis biopsies from men with impaired spermatogenesis. {ECO
• Sequence:

  MRTKQVNLLITLVAVALFSFSCFSIYRITQTNNQLINCRNHILEFKENMLHLRNKTEKNTQEMMKVLNRMKYEIT
  KREILSGNLVAQKADILNKNETVSNTFEDLKFFFPHLRKEGRIYPDVIIGKGKTGVSFALGISTVNRGNYSYLKQ
  TLTSVVSRMTLSQEKDSVVIVLVADSNEDYLHSVVKMITKKFKRQVRSGSLEVISIPAFLYSSMLNAKHLAEASQ
  KLASWRIKQVLDFCILLLYAQPKAKYYLQLEDDIIAKEMYFTKITDFVGNISSNNWFFIEFSMLGFIGKLFRSED
  LTHFVRFFLMFYKEKPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGIHSSFPRKEQYEKKI

• Structural information:
  • Interpro: IPR006759  
  • STRING: ENSP00000421185
• Other Databases: GeneCards:  MGAT4D  Malacards:  MGAT4D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008375	acetylglucosaminyltransferase activity	IBA	molecular function
GO:0005795	Golgi stack	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005795	Golgi stack	IEA	cellular component
GO:0060051	negative regulation of protein glycosylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray