• Gene id: 1521

Gene Summary

• Gene Symbol: CTSW   Gene   UCSC   Ensembl
• Aliases: LYPN
• Gene name: cathepsin W
• Alternate names: cathepsin W, lymphopain,
• Gene location: 11q13.1 (65879836: 65883740)     Exons: 10     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside
• OMIM: 602364

Protein Summary

• Protein general information: P56202  
  • Name: Cathepsin W (EC 3.4.22. ) (Lymphopain)
  • Length: 376  
  • Mass: 42120
  • Tissue specificity: Expressed predominantly in natural killer cells, and in cytotoxic T cells. {ECO
• Sequence:

  MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQR
  LQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVASAISPIKDQKNC
  NCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHR
  CHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGS
  VKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCP
  P

• Structural information:
  • Interpro: IPR033158  IPR038765  IPR025661  IPR025660  IPR000668   IPR039417  IPR013201  
  • Prosite: PS00640 PS00639
  • CDD: cd02248
  • STRING: ENSP00000311300
• Other Databases: GeneCards:  CTSW  Malacards:  CTSW

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051603	proteolysis involved in cellular protein catabolic process	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome
hsa04210	Apoptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R