• Gene id: 150165

Gene Summary

• Gene Symbol: XKR3   Gene   UCSC   Ensembl
• Aliases: XRG3, XTES
• Gene name: XK related 3
• Alternate names: XK-related protein 3, X Kell blood group precursor-related family, member 3, X-linked Kx blood group related 3, XK, Kell blood group complex subunit-related family, member 3, expressed in testis, x Kell blood group-related 3,
• Gene location: 22q11.1 (16825411: 16783411)     Exons: 5     NC_000022.11
• Gene summary(Entrez): XKRX (MIM 300684) and XKR3 are homologs of the Kell blood group precursor XK (MIM 314850), which is a putative membrane transporter and a component of the XK/Kell complex of the Kell blood group system (Calenda et al., 2006 [PubMed 16431037]).[supplied by
• OMIM: 611674

Protein Summary

• Protein general information: Q5GH77  
  • Name: XK related protein 3 (X Kell blood group related 3) (XTES)
  • Length: 459  
  • Mass: 53448
  • Tissue specificity: Expressed predominantly, if not exclusively, in testis. {ECO
• Sequence:

  METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYCGEVAFGLYMFEIYRKANDTFWMSFTISFII
  VGAILDQIILMFFNKDLRRNKAALLFWHILLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIA
  FSIRDNFMQQKAFKYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQISNDD
  TTIKLPPIEFFCVVMWRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPWLEFWKSGAHLPGNKENNSNM
  VGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQRWGHRILHYSFQFLENVIMILVFRFFGGKTLLNCCD
  SLIAVQLIISYLLATGFMLLFYQYLYPWQSGKVLPGRTENQPEAPYYYVNIEKTEKNKNKQLRNYCHSCNRVGYF
  SIRKSMTCS

• Structural information:
  • Interpro: IPR018629  
  • STRING: ENSP00000331704
• Other Databases: GeneCards:  XKR3  Malacards:  XKR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)