• Gene id: 149685

Gene Summary

• Gene Symbol: ADIG   Gene   UCSC   Ensembl
• Aliases: SMAF1
• Gene name: adipogenin
• Alternate names: adipogenin, adipogenesis associated, small adipocyte factor 1 (SMAF1),
• Gene location: 20q11.23 (38581196: 38588462)     Exons: 3     NC_000020.11
• Gene summary(Entrez): ADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation (Kim et al., 2005 [PubMed 15567149]; Hong et al., 2005 [PubMed 16132694]).[supplied by OMIM, Mar 2008]
• OMIM: 611396

Protein Summary

• Protein general information: Q0VDE8  
  • Name: Adipogenin
  • Length: 80  
  • Mass: 9465
• Sequence:

  MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEK
  ERPCW

• Structural information:
  • Interpro: IPR027938  
  • STRING: ENSP00000440331
• Other Databases: GeneCards:  ADIG  Malacards:  ADIG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0050873	brown fat cell differentiation	ISS	biological process
GO:0050872	white fat cell differentiation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0050873	brown fat cell differentiation	IBA	biological process
GO:0050872	white fat cell differentiation	IBA	biological process
GO:0005811	lipid droplet	IBA	cellular component
GO:0045444	fat cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0050872	white fat cell differentiation	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq