• Gene id: 149428

Gene Summary

• Gene Symbol: BNIPL   Gene   UCSC   Ensembl
• Aliases: BNIP-S, BNIP-Salpha, BNIP-Sbeta, BNIPL-1, BNIPL-2, BNIPL1, BNIPL2, BNIPS, PP753
• Gene name: BCL2 interacting protein like
• Alternate names: bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein, BCL2/adenovirus E1B 19kD interacting protein like, BNIP-2 similar,
• Gene location: 1q21.3 (206865246: 206869222)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding di
• OMIM: 611275

Protein Summary

• Protein general information: Q7Z465  
  • Name: Bcl 2/adenovirus E1B 19 kDa interacting protein 2 like protein
  • Length: 357  
  • Mass: 39713
  • Tissue specificity: Isoform 2 is expressed in placenta and lung. {ECO
• Sequence:

  MGTIQEAGKKTDVGVREIAEAPELGAALRHGELELKEEWQDEEFPRLLPEEAGTSEDPEDPKGDSQAAAGTPSTL
  ALCGQRPMRKRLSAPELRLSLTKGPGNDGASPTQSAPSSPDGSSDLEIDELETPSDSEQLDSGHEFEWEDELPRA
  EGLGTSETAERLGRGCMWDVTGEDGHHWRVFRMGPREQRVDMTVIEPYKKVLSHGGYHGDGLNAVILFASCYLPR
  SSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY
  VKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLDRDLHGSGGT

• Structural information:
  • Protein Domains: (191..35-)
    (/note="CRAL-TRIO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00056"-)
  • Interpro: IPR022181  IPR001251  IPR036865  
  • Prosite: PS50191
  • CDD: cd00170
  • STRING: ENSP00000357927
• Other Databases: GeneCards:  BNIPL  Malacards:  BNIPL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006798	polyphosphate catabolic process	IBA	biological process
GO:0004309	exopolyphosphatase activity	IBA	molecular function
GO:0006915	apoptotic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0040009	regulation of growth rate	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq