• Gene id: 148641

Gene Summary

• Gene Symbol: SLC35F3   Gene   UCSC   Ensembl
• Gene name: solute carrier family 35 member F3
• Alternate names: putative thiamine transporter SLC35F3,
• Gene location: 1q42.2 (233904675: 234324517)     Exons: 10     NC_000001.11

Protein Summary

• Protein general information: Q8IY50  
  • Name: Putative thiamine transporter SLC35F3 (Solute carrier family 35 member F3)
  • Length: 421  
  • Mass: 46817
• Sequence:

  MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGVAVVLC
  VCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFFGDNGLTLKVF
  FTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYAD
  GFHSHSVIGIALVVASASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDI
  PWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVIAIIIIGLGFLLLLLP
  EEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFAR

• Structural information:
  • Interpro: IPR000620  IPR026505  
  • STRING: ENSP00000355577
• Other Databases: GeneCards:  SLC35F3  Malacards:  SLC35F3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015888	thiamine transport	IBA	biological process
GO:0015888	thiamine transport	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq