• Gene id: 148109

Gene Summary

• Gene Symbol: FAM187B   Gene   UCSC   Ensembl
• Aliases: TMEM162
• Gene name: family with sequence similarity 187 member B
• Alternate names: protein FAM187B, transmembrane protein 162,
• Gene location: 19q13.12 (35228724: 35224800)     Exons: 16     NC_000019.10

Protein Summary

• Protein general information: Q17R55  
  • Name: Protein FAM187B (Transmembrane protein 162)
  • Length: 369  
  • Mass: 42387
• Sequence:

  MPPMLWLLLHFAAPALGFYFSISCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKKGRLTSLTNISNMEIM
  PEGSLLIKDPLPSQTGLYHCWNKNGRQVVQYEIDFQDVTTLHITHKDLGQRPLQNETLHLGSKQLIFTWWEPWQD
  CNRCEEPGECKRLGYRYIEEPLEEAMPCWLYLGEVLVWSSRLRPELQVEACHVQCTNNTQLRVDYVIFDNFRLDE
  KTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQPAVYKCFVQQELVAQFKPAA
  SLETLEAQWRENDAQWREARKALRGRADSVLKGLKLVLLVVTVLALLGALLKCIHPSPGRRSTQVLVVK

• Structural information:
  • Interpro: IPR039311  IPR036179  
  • STRING: ENSP00000323355
• Other Databases: GeneCards:  FAM187B  Malacards:  FAM187B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)