|
Gene id |
147920 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
IGFL2 Gene UCSC Ensembl |
|
Aliases |
UNQ645, VPRI645 |
|
Gene name |
IGF like family member 2 |
|
Alternate names |
insulin growth factor-like family member 2, |
|
Gene location |
19q13.32 (82262762: 82130219) Exons: 22 NC_000015.10
|
|
Gene summary(Entrez) |
IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[s
|
|
OMIM |
610545 |
Protein Summary
|
| Protein general information
| Q6UWQ7
Name: Insulin growth factor like family member 2
Length: 119 Mass: 13248
Tissue specificity: Detected in cerebellum, heart, placenta, spleen, stomach, testis and thymus. {ECO
|
| Sequence |
MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPC FELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
|
| Structural information |
|
| Other Databases |
GeneCards: IGFL2  Malacards: IGFL2 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005615 |
extracellular space
|
IBA |
cellular component |
GO:0005102 |
signaling receptor bindin g
|
IBA |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0005615 |
extracellular space
|
IDA |
cellular component |
GO:0008150 |
biological_process
|
ND |
biological process |
GO:0005102 |
signaling receptor bindin g
|
IPI |
molecular function |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|