• Gene id: 147710

Gene Summary

• Gene Symbol: IGSF23   Gene   UCSC   Ensembl
• Gene name: immunoglobulin superfamily member 23
• Alternate names: immunoglobulin superfamily member 23,
• Gene location: 19q13.31 (44612576: 44636780)     Exons: 8     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein that has one immunoglobulin (Ig) domain and is a member of the immunoglobulin superfamily. Proteins in this superfamily are usually found on or in cell membranes and act as receptors in immune response pathways. [provided by Re

Protein Summary

• Protein general information: A1L1A6  
  • Name: Immunoglobulin superfamily member 23
  • Length: 192  
  • Mass: 20591
• Sequence:

  MRAKPQSPLPRNPVPAWSPPTTTTDPMLEKDAAGGDFPANLVLQLMPLKTFPAAIRGVIQSELNYSVILQWVVTM
  DPEPVLSWTFSGVPCGMGEKLFIRRLSCEQLGTYMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSL
  SGGSAIGLLAAGILGAGALIAGMCFIIIQSLRTDRQRIGICS

• Structural information:
  • Protein Domains: (20..12-)
    (/note="Ig-like"-)
  • Interpro: IPR007110  IPR036179  IPR013783  
  • Prosite: PS50835
  • STRING: ENSP00000385592
• Other Databases: GeneCards:  IGSF23  Malacards:  IGSF23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray