|
Gene id |
147323 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
STARD6 Gene UCSC Ensembl |
|
Gene name |
StAR related lipid transfer domain containing 6 |
|
Alternate names |
stAR-related lipid transfer protein 6, START domain containing 6, START domain-containing protein 6, StAR-related lipid transfer (START) domain containing 6, |
|
Gene location |
18q21.2 (54357857: 54324491) Exons: 8 NC_000018.10
|
|
Gene summary(Entrez) |
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, afte
|
|
OMIM |
607051 |
Protein Summary
|
| Protein general information
| P59095
Name: StAR related lipid transfer protein 6 (START domain containing protein 6) (StARD6)
Length: 220 Mass: 25022
|
| Sequence |
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWD KSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHP CGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS
|
| Structural information |
|
| Other Databases |
GeneCards: STARD6  Malacards: STARD6 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0008289 |
lipid binding
|
IEA |
molecular function |
GO:0008289 |
lipid binding
|
IEA |
molecular function |
GO:0006869 |
lipid transport
|
IEA |
biological process |
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Asthenoozoospermia | MIK: 32167074 |
| Hypospermatogenesis | MIK: 28361989 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
| 28361989 |
Hyposperma togenesis
|
|
|
6 (3 controls, 3 Klienfelter s yndrome
|
Male infertility |
Microarray
|
Show abstract |
| 32167074 |
Asthenoozo ospermia
|
|
|
12 (6controls, 6 cases)
|
Male infertility |
Microarray
|
Show abstract |
|