• Gene id: 147111

Gene Summary

• Gene Symbol: NOTUM   Gene   UCSC   Ensembl
• Aliases: hNOTUM
• Gene name: notum, palmitoleoyl-protein carboxylesterase
• Alternate names: palmitoleoyl-protein carboxylesterase NOTUM, [Wnt protein] O-palmitoleoyl-L-serine hydrolase, notum pectinacetylesterase homolog, protein notum homolog,
• Gene location: 17q25.3 (81961186: 81952506)     Exons: 11     NC_000017.11
• OMIM: 605829

Protein Summary

• Protein general information: Q6P988  
  • Name: Palmitoleoyl protein carboxylesterase NOTUM (EC 3.1.1.98) (hNOTUM)
  • Length: 496  
  • Mass: 55699
  • Tissue specificity: Rarely expressed in adult normal tissues. {ECO
• Sequence:

  MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQ
  SLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSR
  DWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKV
  LLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNG
  VVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTL
  KDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCP
  TVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS

• Structural information:
  • Interpro: IPR004963  
  • PDB: 4UYU 4UYW 4UYZ 4UZ1 4UZ5 4UZ6 4UZ7 4UZ9 4UZA 4UZL 4UZQ 4WBH 6R8P 6R8Q 6R8R 6T2H 6T2K 6TR5 6TR6 6TR7
  • PDBsum: 4UYU 4UYW 4UYZ 4UZ1 4UZ5 4UZ6 4UZ7 4UZ9 4UZA 4UZL 4UZQ 4WBH 6R8P 6R8Q 6R8R 6T2H 6T2K 6TR5 6TR6 6TR7
  • DIP: 61508
  • STRING: ENSP00000387310
• Other Databases: GeneCards:  NOTUM  Malacards:  NOTUM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0052689	carboxylic ester hydrolase activity	IBA	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:1990697	protein depalmitoleylation	IBA	biological process
GO:1990699	palmitoleyl hydrolase activity	IBA	molecular function
GO:1990699	palmitoleyl hydrolase activity	IDA	molecular function
GO:1990697	protein depalmitoleylation	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0004629	phospholipase C activity	TAS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990699	palmitoleyl hydrolase activity	IEA	molecular function
GO:1990697	protein depalmitoleylation	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq