• Gene id: 147011

Gene Summary

• Gene Symbol: PROCA1   Gene   UCSC   Ensembl
• Gene name: protein interacting with cyclin A1
• Alternate names: protein PROCA1, proline-rich cyclin A1-interacting protein,
• Gene location: 17q11.2 (28712064: 28703196)     Exons: 44     NC_000017.11
• OMIM: 617376

Protein Summary

• Protein general information: Q8NCQ7  
  • Name: Protein PROCA1 (Protein interacting with cyclin A1)
  • Length: 364  
  • Mass: 40506
  • Tissue specificity: High expressed in testis. {ECO
• Sequence:

  MWVRTTLTIERWTKEKTEPKARSWDEALSDVNRLPSWERGHLLAGVASSTDVSTFSEGGDCKEPDKCCWRHKQCT
  GHIIYPFASDCVRHSLHLHSVNHCNCNSRLKDSSEDSSSSRGAGPTCSHVIESPCFELTPEEEHVERFRYGWCKS
  YRPVSVAVIHHPLYHECGADDLNEEEEEEEEESKPPIPTQVGPATASPDLGTSMATGTPDSTAPITIWRSESPTG
  KGQGSKVIKKVKKKKEKEKDKEEMDEKAKLKKKAKKGQLTKKKSPVKLEPSPPDVSRSLSARQLARMSESSPESR
  EELESEDSYNGRGQGELSSEDIVESSSPRKRENTVQAKKTGAKPSQARKVNKRKSPPGSNPNLS

• Structural information:
  • Interpro: IPR016090  IPR036444  
  • STRING: ENSP00000301039
• Other Databases: GeneCards:  PROCA1  Malacards:  PROCA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0030332	cyclin binding	IPI	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)