• Gene id: 146894

Gene Summary

• Gene Symbol: CD300LG   Gene   UCSC   Ensembl
• Aliases: CLM-9, CLM9, NEPMUCIN, TREM-4, TREM4
• Gene name: CD300 molecule like family member g
• Alternate names: CMRF35-like molecule 9, CD300 antigen-like family member G, triggering receptor expressed on myeloid cells 4,
• Gene location: 17q21.31 (43847096: 43863638)     Exons: 10     NC_000017.11
• Gene summary(Entrez): Members of the CD300 (see MIM 606786)-like (CD300L) family, such as CD300LG, are widely expressed on hematopoietic cells. All CD300L proteins are type I cell surface glycoproteins that contain a single immunoglobulin (Ig) V-like domain (Takatsu et al., 20
• OMIM: 610520

Protein Summary

• Protein general information: Q6UXG3  
  • Name: CMRF35 like molecule 9 (CLM 9) (CD300 antigen like family member G) (Triggering receptor expressed on myeloid cells 4) (TREM 4) (CD antigen CD300g)
  • Length: 332  
  • Mass: 36060
  • Tissue specificity: Highly expressed in heart, skeletal muscle and placenta. {ECO
• Sequence:

  MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETM
  KGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKA
  KAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSA
  EDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEK
  EAPSQAPEGDVISMPPLHTSEEELGFSKFVSA

• Structural information:
  • Protein Domains: (19..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000321005
• Other Databases: GeneCards:  CD300LG  Malacards:  CD300LG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005768	endosome	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0032585	multivesicular body membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq