• Gene id: 1466

Gene Summary

• Gene Symbol: CSRP2   Gene   UCSC   Ensembl
• Aliases: CRP2, LMO5, SmLIM
• Gene name: cysteine and glycine rich protein 2
• Alternate names: cysteine and glycine-rich protein 2, LIM domain only 5, smooth muscle, LIM domain only protein 5, LMO-5, cysteine-rich protein 2, epididymis secretory sperm binding protein, smooth muscle cell LIM protein,
• Gene location: 12q21.2 (76879018: 76858708)     Exons: 6     NC_000012.12
• Gene summary(Entrez): CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence
• OMIM: 601871

Protein Summary

• Protein general information: Q16527  
  • Name: Cysteine and glycine rich protein 2 (Cysteine rich protein 2) (CRP2) (LIM domain only protein 5) (LMO 5) (Smooth muscle cell LIM protein) (SmLIM)
  • Length: 193  
  • Mass: 20954
  • Tissue specificity: Highly expressed in the aorta, but not in heart and skeletal muscle.
• Sequence:

  MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQ
  GAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCG
  KSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

• Structural information:
  • Protein Domains: (10..6-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (119..17-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • STRING: ENSP00000310901
• Other Databases: GeneCards:  CSRP2  Malacards:  CSRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0030154	cell differentiation	NAS	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)