• Gene id: 146434

Gene Summary

• Gene Symbol: ZNF597   Gene   UCSC   Ensembl
• Aliases: HIT-4
• Gene name: zinc finger protein 597
• Alternate names: zinc finger protein 597,
• Gene location: 16p13.3 (3443503: 3432413)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene encodes a protein with multiple zinc finger domains. Loss of the related gene in rodents results in defects in neural development and embryonic lethality in mutant homozygotes. This gene is adjacent to a differentially methylated region (DMR) an
• OMIM: 614685

Protein Summary

• Protein general information: Q96LX8  
  • Name: Zinc finger protein 597
  • Length: 424  
  • Mass: 48076
• Sequence:

  MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPEINQQLSLESMELDEL
  ALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLLVTIENHTPLVELSEYLGTNTLSEILDSPWE
  GAKNVYKCPECDQNFSDHSYLVLHQKIHSGEKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHS
  HLSRHMNSHVKEKPYTCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTK
  CMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTFPCFSELISHQNIHTEERPHKCKTCE
  ESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHIKNTT

• Structural information:
  • Protein Domains: (14..8-)
    (/note="KRAB"-)
  • Interpro: IPR001909  IPR036051  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • CDD: cd07765
  • STRING: ENSP00000301744
• Other Databases: GeneCards:  ZNF597  Malacards:  ZNF597

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Plays a crucial role in speramtogenesis	MIK: 25609838
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)