• Gene id: 146223

Gene Summary

• Gene Symbol: CMTM4   Gene   UCSC   Ensembl
• Aliases: CKLFSF4
• Gene name: CKLF like MARVEL transmembrane domain containing 4
• Alternate names: CKLF-like MARVEL transmembrane domain-containing protein 4, chemokine-like factor super family 4, chemokine-like factor superfamily member 4,
• Gene location: 16q21-q22.1 (20497304: 20441518)     Exons: 11     NC_000022.11
• Gene summary(Entrez): This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on
• OMIM: 607887

Protein Summary

• Protein general information: Q8IZR5  
  • Name: CKLF like MARVEL transmembrane domain containing protein 4 (Chemokine like factor superfamily member 4)
  • Length: 234  
  • Mass: 25828
  • Tissue specificity: Highly expressed in testis and prostate. {ECO
• Sequence:

  MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETI
  MACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAE
  IAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNL
  LSLNHWQLA

• Structural information:
  • Protein Domains: (49..17-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  
  • Prosite: PS51225
  • STRING: ENSP00000333833
• Other Databases: GeneCards:  CMTM4  Malacards:  CMTM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq