• Gene id: 145748

Gene Summary

• Gene Symbol: LYSMD4   Gene   UCSC   Ensembl
• Gene name: LysM domain containing 4
• Alternate names: lysM and putative peptidoglycan-binding domain-containing protein 4, LysM, putative peptidoglycan-binding, domain containing 4,
• Gene location: 15q26.3 (99733457: 99714797)     Exons: 7     NC_000015.10
• OMIM: 602206

Protein Summary

• Protein general information: Q5XG99  
  • Name: LysM and putative peptidoglycan binding domain containing protein 4
  • Length: 296  
  • Mass: 32066
• Sequence:

  MRHEELLTKTFQGPAVVCGTPTSHVYMFKNGSGDSGDSSEEESHRVVLRPRGKERHKSGVHQPPQAGAGDVVLLQ
  RELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELP
  EADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIM
  LLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS

• Structural information:
  • Protein Domains: (74..11-)
    (/note="LysM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01118"-)
  • Interpro: IPR018392  IPR036779  
  • Prosite: PS51782
  • CDD: cd00118
  • STRING: ENSP00000342840
• Other Databases: GeneCards:  LYSMD4  Malacards:  LYSMD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881