• Gene id: 145376

Gene Summary

• Gene Symbol: PPP1R36   Gene   UCSC   Ensembl
• Aliases: C14orf50
• Gene name: protein phosphatase 1 regulatory subunit 36
• Alternate names: protein phosphatase 1 regulatory subunit 36,
• Gene location: 14q23.3 (64549895: 64589385)     Exons: 14     NC_000014.9

Protein Summary

• Protein general information: Q96LQ0  
  • Name: Protein phosphatase 1 regulatory subunit 36
  • Length: 422  
  • Mass: 49440
• Sequence:

  MYRVPEFYARRKRLGGQTPYLMDQLGLRLGMWYWKDETRTLEFRRFAAEDSVQWLLKHHPHFTPAAEVKEKGKKG
  KAVHFAETDGPASDRLTDKRLAAKDDKSAKAVEKRGQQGTITLDDVKFVTLLLLQDTEMQRICSFTTFMRNKNLD
  NFLMALLYYLSHYLEKNSLEKKPKSYMVGLVEKKEMELVLSELEAAQRYLAQKYCILVLGLAVPDKHHMCCGKEK
  ISDTQKDWKFFESFYTFCTYVAWIVFRRQHLTEIEEEVGRLFRTNMFNIPRRRREDEESGGEKKRMTFVQFRRMM
  AKRPAIKKAINMRSPVMSTLLPSLREKAQNVFEKKYHQVDVRFPAEMQKHVGTLDSVPMPVVGILGEPRCLFNPH
  TLHPLDPEENTKSFGRYPSLMENNNMRIQDTLDLVMKTLSSHTSCPK

• Structural information:
  • Interpro: IPR026142  
  • STRING: ENSP00000298705
• Other Databases: GeneCards:  PPP1R36  Malacards:  PPP1R36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010923	negative regulation of phosphatase activity	IBA	biological process
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0010923	negative regulation of phosphatase activity	IEA	biological process
GO:0019902	phosphatase binding	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881