• Gene id: 145264

Gene Summary

• Gene Symbol: SERPINA12   Gene   UCSC   Ensembl
• Aliases: OL-64
• Gene name: serpin family A member 12
• Alternate names: serpin A12, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12, vaspin, visceral adipose tissue-derived serine protease inhi,
• Gene location: 14q32.13 (94517843: 94481650)     Exons: 9     NC_000014.9
• OMIM: 610540

Protein Summary

• Protein general information: Q8IW75  
  • Name: Serpin A12 (OL 64) (Visceral adipose tissue derived serine protease inhibitor) (Vaspin) (Visceral adipose specific serpin)
  • Length: 414  
  • Mass: 47175
  • Tissue specificity: Expressed in visceral adipose tissues. {ECO
• Sequence:

  MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLS
  PLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKF
  LEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKE
  EDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLS
  RRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQT
  LPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK

• Structural information:
  • Interpro: IPR023796  IPR000215  IPR036186  IPR042178  IPR042185  
  • PDB: 4IF8 4Y3K 4Y40 5EI0
  • PDBsum: 4IF8 4Y3K 4Y40 5EI0
  • STRING: ENSP00000342109
• Other Databases: GeneCards:  SERPINA12  Malacards:  SERPINA12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0090207	regulation of triglyceride metabolic process	IEA	biological process
GO:0090181	regulation of cholesterol metabolic process	IEA	biological process
GO:0051055	negative regulation of lipid biosynthetic process	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0045721	negative regulation of gluconeogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq