• Gene id: 144448

Gene Summary

• Gene Symbol: TSPAN19   Gene   UCSC   Ensembl
• Gene name: tetraspanin 19
• Alternate names: putative tetraspanin-19, tspan-19,
• Gene location: 12q21.31 (85036277: 85014310)     Exons: 10     NC_000012.12
• OMIM: 616578

Protein Summary

• Protein general information: P0C672  
  • Name: Putative tetraspanin 19 (Tspan 19)
  • Length: 248  
  • Mass: 28460
• Sequence:

  MLRNNKTIIIKYFLNLINGAFLVLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVPISQILIGMGSSTVLFCLLGY
  IGIHNEIRWLLIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHDKIDFVISEYGSKDKPEDITKWTILNALQKT
  LQCCGQHNYTDWIKNKNKENSGQVPCSCTKSTLRKWFCDEPLNATYLEGCENKISAWYNVNVLTLIGINFGLLTS
  EVFQVSLTVCFFKNIKNIIHAEM

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR008952  
  • STRING: ENSP00000433816
• Other Databases: GeneCards:  TSPAN19  Malacards:  TSPAN19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray