• Gene id: 144321

Gene Summary

• Gene Symbol: GLIPR1L2   Gene   UCSC   Ensembl
• Gene name: GLIPR1 like 2
• Alternate names: GLIPR1-like protein 2, GLI pathogenesis related 1 like 2,
• Gene location: 12q21.2 (103529195: 103537072)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with
• OMIM: 610394

Protein Summary

• Protein general information: Q4G1C9  
  • Name: GLIPR1 like protein 2
  • Length: 344  
  • Mass: 40179
  • Tissue specificity: Highly expressed in testis. Detected in prostate, kidney, bladder, lung and bone marrow. {ECO
• Sequence:

  MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNL
  RFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGS
  CSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSN
  ADRDQATYYRFWYPKWEMPRPVVCDPLCTFILLLRILCFILCVITVLIVQSQFPNILLEQQMIFTPEESEAGNEE
  EEKEEEKKEKEEMEMEIMEMEEEKEEREEEEEETQKEKMEEEEK

• Structural information:
  • Protein Domains: (58..19-)
    (/note="SCP"-)
  • Interpro: IPR014044  IPR035940  IPR001283  
  • STRING: ENSP00000448248
• Other Databases: GeneCards:  GLIPR1L2  Malacards:  GLIPR1L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray