• Gene id: 144108

Gene Summary

• Gene Symbol: SPTY2D1   Gene   UCSC   Ensembl
• Aliases: Spt2
• Gene name: SPT2 chromatin protein domain containing 1
• Alternate names: protein SPT2 homolog, SPT2 domain-containing protein 1, SPT2, Suppressor of Ty, domain containing 1,
• Gene location: 11p15.1 (18634822: 18606400)     Exons: 7     NC_000011.10

Protein Summary

• Protein general information: Q68D10  
  • Name: Protein SPT2 homolog (Protein KU002155) (SPT2 domain containing protein 1)
  • Length: 685  
  • Mass: 75599
• Sequence:

  MDFREILMIASKGQGVNNVPKRYSLAVGPPKKDPKVKGVQSAAVQAFLKRKEEELRRKALEEKRRKEELVKKRIE
  LKHDKKARAMAKRTKDNFHGYNGIPIEEKSKKRQATESHTSQGTDREYEMEEENEFLEYNHAESEQEYEEEQEPP
  KVESKPKVPLKSAPPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHRRKKLETDGKLPP
  TVSKKAPSQKESVGTKLSKGSGDRHPSSKGMPLPHAEKKSRPSMANEKHLALSSSKSMPGERIKAGSGNSSQPSL
  REGHDKPVFNGAGKPHSSTSSPSVPKTSASRTQKSAVEHKAKKSLSHPSHSRPGPMVTPHNKAKSPGVRQPGSSS
  SSAPGQPSTGVARPTVSSGPVPRRQNGSSSSGPERSISGSKKPTNDSNPSRRTVSGTCGPGQPASSSGGPGRPIS
  GSVSSARPLGSSRGPGRPVSSPHELRRPVSGLGPPGRSVSGPGRSISGSIPAGRTVSNSVPGRPVSSLGPGQTVS
  SSGPTIKPKCTVVSETISSKNIISRSSNGQMNGMKPPLSGYRAAQGPQRLPFPTGYKRQREYEEEDDDDDEYDSE
  MEDFIEDEGEPQEEISKHIREIFGYDRKKYKDESDYALRYMESSWKEQQKEEAKSLRLGMQEDLEEMRREEEEMQ
  RRRAKKLKRR

• Structural information:
  • Interpro: IPR013256  
  • PDB: 5BS7 5BSA
  • PDBsum: 5BS7 5BSA
  • STRING: ENSP00000337991
• Other Databases: GeneCards:  SPTY2D1  Malacards:  SPTY2D1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0010847	regulation of chromatin assembly	IBA	biological process
GO:0006334	nucleosome assembly	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0043486	histone exchange	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0005730	nucleolus	ISS	cellular component
GO:0001042	RNA polymerase I core binding	ISS	molecular function
GO:0010847	regulation of chromatin assembly	IMP	biological process
GO:0006334	nucleosome assembly	IMP	biological process
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0043486	histone exchange	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)