• Gene id: 144097

Gene Summary

• Gene Symbol: SPINDOC   Gene   UCSC   Ensembl
• Aliases: C11orf84, SPIN-DOC
• Gene name: spindlin interactor and repressor of chromatin binding
• Alternate names: spindlin interactor and repressor of chromatin-binding protein, SPIN1 docking protein, hypothetical protein BC007540, uncharacterized protein C11orf84,
• Gene location: 11q13.1 (63813373: 63827717)     Exons: 8     NC_000011.10
• OMIM: 611161

Protein Summary

• Protein general information: Q9BUA3  
  • Name: Spindlin interactor and repressor of chromatin binding protein (SPIN1 docking protein) (SPIN DOC)
  • Length: 381  
  • Mass: 41037
• Sequence:

  MALKAEGAALDCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQ
  EFLVGSSPGGSGRALCMVCGAEIRAPSADTARSHILEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPP
  NSDSGQDAHPDPDANPDAARMPAEIVVLLDSEDNPSLPKRSRPRGLRPLELPAVPATEPGNKKPRGQRWKEPPGE
  EPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFSHTQLRGPDSKDSPKDREVAE
  GGLPRAESPSPAPPPGLRGTLDLQVIRVRMEEPPAVSLLQDWSRHPQGTKRVGAGDTSDWPTVLSESSTTVAGKP
  EKGNGV

• Structural information:
  • Interpro: IPR040647  
  • STRING: ENSP00000294244
• Other Databases: GeneCards:  SPINDOC  Malacards:  SPINDOC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq