• Gene id: 1434

Gene Summary

• Gene Symbol: CSE1L   Gene   UCSC   Ensembl
• Aliases: CAS, CSE1, XPO2
• Gene name: chromosome segregation 1 like
• Alternate names: exportin-2, CSE1 chromosome segregation 1-like, cellular apoptosis susceptibility protein, chromosome segregation 1-like protein, epididymis secretory sperm binding protein, exp2, importin-alpha re-exporter,
• Gene location: 20q13.13 (49046245: 49096959)     Exons: 25     NC_000020.11
• Gene summary(Entrez): Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation
• OMIM: 601342

Protein Summary

• Protein general information: P55060  
  • Name: Exportin 2 (Exp2) (Cellular apoptosis susceptibility protein) (Chromosome segregation 1 like protein) (Importin alpha re exporter)
  • Length: 971  
  • Mass: 110417
  • Tissue specificity: Detected in brain, placenta, ovary, testis and trachea (at protein level) (PubMed
• Sequence:

  MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWR
  IVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQSGDFHVINGVL
  RTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQ
  DLPEFFEDNMETWMNNFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
  LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLE
  GSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQKHGITQ
  ANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHA
  LERLFTMRGPNNATLFTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
  KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQEFIPYVFQVMSLLLETHK
  NDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKANDHQGFYL
  LNSIIEHMPPESVDQYRKQIFILLFQRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKI
  IIPEIQKVSGNVEKKICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ
  TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL

• Structural information:
  • Protein Domains: (29..10-)
    (/note="Importin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00115"-)
  • Interpro: IPR011989  IPR016024  IPR001494  IPR005043  IPR013713  
  • Prosite: PS50166
  • DIP: 32573
  • STRING: ENSP00000262982
• Other Databases: GeneCards:  CSE1L  Malacards:  CSE1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005635	nuclear envelope	IBA	cellular component
GO:0006606	protein import into nucleus	IBA	biological process
GO:0005049	nuclear export signal receptor activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006611	protein export from nucleus	IBA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005049	nuclear export signal receptor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)