• Gene id: 142689

Gene Summary

• Gene Symbol: ASB12   Gene   UCSC   Ensembl
• Gene name: ankyrin repeat and SOCS box containing 12
• Alternate names: ankyrin repeat and SOCS box protein 12, ankyrin repeat domain-containing SOCS box protein Asb-12,
• Gene location: Xq11.2 (51489099: 51730726)     Exons: 22     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) protein
• OMIM: 300891

Protein Summary

• Protein general information: Q8WXK4  
  • Name: Ankyrin repeat and SOCS box protein 12 (ASB 12)
  • Length: 309  
  • Mass: 33943
• Sequence:

  MNLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRLAASYG
  HLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGASPGGSIYNNCSPVLTAARDGAVAILQELL
  DHGAEANVKAKLPVWASNIASCSGPLYLAAVYGHLDCFRLLLLHGADPDYNCTDQGLLARVPRPRTLLEICLHHN
  CEPEYIQLLIDFGANIYLPSLSLDLTSQDDKGIALLLQARATPRSLLSQVRLVVRRALCQAGQPQAINQLDIPPM
  LISYLKHQL

• Structural information:
  • Protein Domains: (268..30-)
    (/note="SOCS-box")
  • Interpro: IPR002110  IPR020683  IPR036770  IPR001496  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000355195
• Other Databases: GeneCards:  ASB12  Malacards:  ASB12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	contributes to
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)