• Gene id: 141

Gene Summary

• Gene Symbol: ADPRH   Gene   UCSC   Ensembl
• Aliases: ARH1, hARH1
• Gene name: ADP-ribosylarginine hydrolase
• Alternate names: ADP-ribosylarginine hydrolase, ADP-ribose-L-arginine cleaving enzyme, [Protein ADP-ribosylarginine] hydrolase,
• Gene location: 3q13.33 (119579491: 119589944)     Exons: 5     NC_000003.12
• Gene summary(Entrez): The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternative
• OMIM: 603081

SNPs

rs62180545

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.216859821A>G
NC_000002.11   g.217724544A>G|SEQ=[A/G]|GENE=TNP1
LOC101928278   101928278

Protein Summary

• Protein general information: P54922  
  • Name: [Protein ADP ribosylarginine] hydrolase (ADP ribosylarginine hydrolase) (hARH1) (EC 3.2.2.19) (ADP ribose L arginine cleaving enzyme)
  • Length: 357  
  • Mass: 39507
• Sequence:

  MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPK
  LTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDT
  LIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQT
  KWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
  GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL

• Structural information:
  • Interpro: IPR012108  IPR005502  IPR036705  
  • PDB: 3HFW 6G28 6G2A 6IUX
  • PDBsum: 3HFW 6G28 6G2A 6IUX
  • STRING: ENSP00000420200
• Other Databases: GeneCards:  ADPRH  Malacards:  ADPRH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090630	activation of GTPase activity	IBA	biological process
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0006464	cellular protein modification process	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IBA	molecular function
GO:0030955	potassium ion binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IDA	molecular function
GO:0051725	protein de-ADP-ribosylation	IDA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IEA	molecular function
GO:0051725	protein de-ADP-ribosylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006464	cellular protein modification process	IEA	biological process
GO:0006464	cellular protein modification process	IEA	biological process
GO:0003875	ADP-ribosylarginine hydrolase activity	IEA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IEA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IMP	molecular function
GO:0006464	cellular protein modification process	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)