• Gene id: 1408

Gene Summary

• Gene Symbol: CRY2   Gene   UCSC   Ensembl
• Aliases: HCRY2, PHLL2
• Gene name: cryptochrome circadian regulator 2
• Alternate names: cryptochrome-2, cryptochrome 2 (photolyase-like), cryptochrome circadian clock 2, growth-inhibiting protein 37,
• Gene location: 11p11.2 (45847117: 45883247)     Exons: 13     NC_000011.10
• Gene summary(Entrez): This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulatio
• OMIM: 611141

SNPs

rs3197744

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.1937841G>T
NC_000020.10   g.1918487G>T
XM_006723545.4   c.*273G>T
XM_005260670.3   c.*273G>T
XM_005260670.1   c.*273G>T
XM_011529173.2   c.*273G>T
NM_080792.2   c.*273G>T
NM_080792.3   c.*273G>T
NM_001330728.1   c.*273G>T
NM_001040022.1   c.*273G>T
NM_0  

Protein Summary

• Protein general information: Q49AN0  
  • Name: Cryptochrome 2
  • Length: 593  
  • Mass: 66947
  • Tissue specificity: Expressed in all tissues examined including fetal brain, fibroblasts, heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Highest level
• Sequence:

  MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLL
  QSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHT
  LYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLG
  PAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNST
  PPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHL
  ARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRR
  YLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSC
  VEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA

• Structural information:
  • Protein Domains: (22..15-)
    (/note="Photolyase/cryptochrome-alpha/beta")
  • Interpro: IPR036134  IPR036155  IPR005101  IPR006050  IPR014729  
  • Prosite: PS51645
  • DIP: 47396
  • STRING: ENSP00000478187
• Other Databases: GeneCards:  CRY2  Malacards:  CRY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:2000323	negative regulation of glucocorticoid receptor signaling pathway	ISS	biological process
GO:0071949	FAD binding	ISS	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0014823	response to activity	ISS	biological process
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009416	response to light stimulus	ISS	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0009881	photoreceptor activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0018298	protein-chromophore linkage	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:2000118	regulation of sodium-dependent phosphate transport	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0009416	response to light stimulus	IMP	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0003914	DNA (6-4) photolyase activity	IDA	NOT|molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003904	deoxyribodipyrimidine photo-lyase activity	IDA	NOT|molecular function
GO:0000719	photoreactive repair	IDA	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019902	phosphatase binding	IPI	molecular function
GO:0009785	blue light signaling pathway	NAS	biological process
GO:0009882	blue light photoreceptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq