• Gene id: 140699

Gene Summary

• Gene Symbol: MROH8   Gene   UCSC   Ensembl
• Aliases: C20orf131, C20orf132
• Gene name: maestro heat like repeat family member 8
• Alternate names: protein MROH8, maestro heat-like repeat-containing protein family member 8,
• Gene location: 20q11.23 (37179547: 37101168)     Exons: 24     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the maestro heat-like repeat family. The exact function of this gene is not known, however, in a genome-wide association study using hippocampal atrophy as a quantitative trait, this gene has been associated wit

Protein Summary

• Protein general information: Q9H579  
  • Name: Protein MROH8 (Maestro heat like repeat containing protein family member 8)
  • Length: 483  
  • Mass: 54816
• Sequence:

  MSSKHRICSQEEVVIPCAYDSDSESVDLELSNLEIIKKGSSSIELTDLDIPDIPGLHCEPLSHSPRHLTQQDPLS
  EAIVEKLIQSIQKVFNGELKGELEKLKFLGDLSSLSQALPYDETAKSFIHSHIADIVHTLNVLVQEERPHSLSSS
  MRQEVFVTIADLSYQDVHLLLGSEDRAELFSLTIKSIITLPSVRTLTQIQEIMPNGTCNTECLYRQTFQAFSEML
  QSLVVKDPHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLHITLRLKYITHDKKDQQNL
  KRALTKCREFLELHSSAAKCFYNCPFRIAQVFEGFLDSNELCQFIMTTFDTLKTLKHPCIQRSAGELLLTLAKNT
  ESQFEKVPEIMGVICAQLSIISQPRVRQQIINTVSLFISRPKYTDIVLSFLLCHPVPYNRHLAEVWRMLSVELPS
  TTWILWRLLRKLQKCHNEPAQEKMAYVAVAVSP

• Structural information:
  • Interpro: IPR016024  
  • STRING: ENSP00000339971
• Other Databases: GeneCards:  MROH8  Malacards:  MROH8

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq