• Gene id: 140686

Gene Summary

• Gene Symbol: WFDC3   Gene   UCSC   Ensembl
• Aliases: WAP14, dJ447F3.3
• Gene name: WAP four-disulfide core domain 3
• Alternate names: WAP four-disulfide core domain protein 3, protease inhibitor WAP14, putative protease inhibitor WAP14, whey acidic protein 14,
• Gene location: 20q13.12 (45791882: 45708859)     Exons: 10     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The enco
• OMIM: 610132

Protein Summary

• Protein general information: Q8IUB2  
  • Name: WAP four disulfide core domain protein 3 (Putative protease inhibitor WAP14)
  • Length: 231  
  • Mass: 24687
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MMLSCLFLLKALLALGSLESWITAGEHAKEGECPPHKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPKGRKRD
  CPRVIRKQSCLKRCITDETCPGVKKCCTLGCNKSCVVPISKQKLAEFGGECPADPLPCEELCDGDASCPQGHKCC
  STGCGRTCLGDIEGGRGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSE
  LEIPVP

• Structural information:
  • Protein Domains: (26..6-)
    (/note="WAP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (69..11-)
    (/note="WAP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (119..16-)
    (/note="WAP-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (-)
  • Interpro: IPR036645  IPR008197  IPR029726  
  • Prosite: PS51390
  • STRING: ENSP00000243938
• Other Databases: GeneCards:  WFDC3  Malacards:  WFDC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0019731	antibacterial humoral response	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881