• Gene id: 140597

Gene Summary

• Gene Symbol: TCEAL2   Gene   UCSC   Ensembl
• Aliases: MY0876G05, WEX1, my048
• Gene name: transcription elongation factor A like 2
• Alternate names: transcription elongation factor A protein-like 2, TCEA-like protein 2, transcription elongation factor A (SII)-like 2, transcription elongation factor S-II protein-like 2,
• Gene location: Xq22.1 (102125678: 102127711)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.
• OMIM: 0

Protein Summary

• Protein general information: Q9H3H9  
  • Name: Transcription elongation factor A protein like 2 (TCEA like protein 2) (Transcription elongation factor S II protein like 2)
  • Length: 227  
  • Mass: 25850
• Sequence:

  MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKAKGEGK
  SERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKRKTNKGLAQYL
  KQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDTEDIP
  YV

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000361866
• Other Databases: GeneCards:  TCEAL2  Malacards:  TCEAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881