Search Result
| Gene id | 140458 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ASB5 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ASB-5 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | ankyrin repeat and SOCS box containing 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | ankyrin repeat and SOCS box protein 5, SOCS box protein ASB-5, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
4q34.2 (176277570: 176213672) Exons: 11 NC_000004.12 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 607009 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8WWX0 Name: Ankyrin repeat and SOCS box protein 5 (ASB 5) Length: 329 Mass: 36341 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYGVTQGQGSWADRSPLH EAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACARTLLEAGANVNAITIDGVTPLFNACSQGSPS CAELLLEYGAKAQLESCLPSPTHEAASKGHHECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGA DVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC IRSYIGKPRLHLIPQLQLPTLLKNFLQYR | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ASB5  Malacards: ASB5 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||