• Gene id: 140258

Gene Summary

• Gene Symbol: KRTAP13-1   Gene   UCSC   Ensembl
• Aliases: KAP13.1, KRTAP13.1
• Gene name: keratin associated protein 13-1
• Alternate names: keratin-associated protein 13-1, high sulfur keratin associated protein 13.1,
• Gene location: 21q22.11 (30396030: 30396821)     Exons: 1     NC_000021.9
• Gene summary(Entrez): Hair keratins and hair keratin-associated proteins (KAPs), such as KRTAP13-1, are the main structural proteins of hair fibers (Rogers et al., 2002 [PubMed 12359730]).[supplied by OMIM, Mar 2008]
• OMIM: 604423

Protein Summary

• Protein general information: Q8IUC0  
  • Name: Keratin associated protein 13 1 (High sulfur keratin associated protein 13.1)
  • Length: 172  
  • Mass: 18320
  • Tissue specificity: Weak expression seen in the late matrix and entire cortex area of the hair follicle. {ECO
• Sequence:

  MSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSP
  CQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSLGYGVGFCRPT
  YLASRSCQSSCYRPTCGSGFYY

• Structural information:
  • Interpro: IPR007951  
  • STRING: ENSP00000347635
• Other Databases: GeneCards:  KRTAP13-1  Malacards:  KRTAP13-1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005882	intermediate filament	IEA	cellular component
GO:0031424	keratinization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881