• Gene id: 139760

Gene Summary

• Gene Symbol: GPR119   Gene   UCSC   Ensembl
• Aliases: GPCR2
• Gene name: G protein-coupled receptor 119
• Alternate names: glucose-dependent insulinotropic receptor, G-protein coupled receptor 2,
• Gene location: Xq26.1 (130385536: 130384344)     Exons: 1     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the rhodopsin subfamily of G-protein-coupled receptors that is expressed in the pancreas and gastrointestinal tract. The encoded protein is activated by lipid amides including lysophosphatidylcholine and oleoylethanolamide an
• OMIM: 300513

Protein Summary

• Protein general information: Q8TDV5  
  • Name: Glucose dependent insulinotropic receptor (G protein coupled receptor 119)
  • Length: 335  
  • Mass: 36889
  • Tissue specificity: Predominantly expressed in the pancreas, especially in the islets. {ECO
• Sequence:

  MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPSRPTQK
  TLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLPLGIPMFQQTA
  YKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALR
  TVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
  LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR028336  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000276218
• Other Databases: GeneCards:  GPR119  Malacards:  GPR119

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0031210	phosphatidylcholine binding	IBA	molecular function
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030073	insulin secretion	IEA	biological process
GO:0031210	phosphatidylcholine binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04911	Insulin secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)